Lineage for d1kenc_ (1ken C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1306037Domain d1kenc_: 1ken C: [72375]
    Other proteins in same PDB: d1kenb_, d1kend_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2

Details for d1kenc_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d1kenc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d1kenc_:

Click to download the PDB-style file with coordinates for d1kenc_.
(The format of our PDB-style files is described here.)

Timeline for d1kenc_: