| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
| Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
| Domain d1kenb_: 1ken B: [72374] Other proteins in same PDB: d1kena_, d1kenc_, d1kene_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2 |
PDB Entry: 1ken (more details), 3.5 Å
SCOPe Domain Sequences for d1kenb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kenb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
Timeline for d1kenb_: