Lineage for d1keja2 (1kej A:243-510)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200829Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 200947Protein Terminal deoxynucleotidyl transferase [69883] (1 species)
  7. 200948Species Mouse (Mus musculus) [TaxId:10090] [69884] (3 PDB entries)
  8. 200951Domain d1keja2: 1kej A:243-510 [72372]
    Other proteins in same PDB: d1keja1

Details for d1keja2

PDB Entry: 1kej (more details), 3 Å

PDB Description: Crystal Structure of Murine Terminal Deoxynucleotidyl Transferase complexed with ddATP

SCOP Domain Sequences for d1keja2:

Sequence, based on SEQRES records: (download)

>d1keja2 e.9.1.1 (A:243-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d1keja2 e.9.1.1 (A:243-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfeqpsrkvdaldhfqkcflilkldhgrvhseksegkgw
kairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvflea
eseeeifahlgldyiepwerna

SCOP Domain Coordinates for d1keja2:

Click to download the PDB-style file with coordinates for d1keja2.
(The format of our PDB-style files is described here.)

Timeline for d1keja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1keja1