SCOPe 2.03: Domain d1ke4b_: 1ke4 B:

Lineage for d1ke4b_ (1ke4 B:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (73 PDB entries)

8. Domain d1ke4b_: 1ke4 B: [72363]
   complexed with po4

Details for d1ke4b_

PDB Entry: 1ke4, 1.72 Å

PDB Description: X-ray crystal structure of AmpC beta-lactamase from E. coli

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1ke4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ke4b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1ke4b_:

• d1ke4b_ first appeared in SCOP 1.61
  
• d1ke4b_ appears in SCOPe 2.02
  
• d1ke4b_ appears in SCOPe 2.04
  
• d1ke4b_ appears in the current release, SCOPe 2.08