SCOP 1.75: Domain d1kdwa_: 1kdw A:

Lineage for d1kdwa_ (1kdw A:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (46 PDB entries)

8. Domain d1kdwa_: 1kdw A: [72356]

Details for d1kdwa_

PDB Entry: 1kdw, 2.28 Å

PDB Description: X-ray crystal structure of AmpC beta-lactamase from E. coli in complex with the inhibitor 4-carboxyphenylboronic acid

PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1kdwa_:

Sequence; same for both SEQRES and ATOM records:

>d1kdwa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1kdwa_:

• d1kdwa_ first appeared in SCOP 1.61
  
• d1kdwa_ appears in SCOP 1.73
  
• d1kdwa_ appears in SCOPe 2.01
  
• d1kdwa_ appears in the current release, SCOPe 2.08