Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein Terminal deoxynucleotidyl transferase [69042] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries) |
Domain d1kdha1: 1kdh A:148-242 [72349] Other proteins in same PDB: d1kdha3, d1kdha4 protein/DNA complex; complexed with mg, na |
PDB Entry: 1kdh (more details), 3 Å
SCOPe Domain Sequences for d1kdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdha1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits mkdtegipclgdkvksiiegiiedgesseakavln
Timeline for d1kdha1: