![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins) |
![]() | Protein Terminal deoxynucleotidyl transferase [69042] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries) |
![]() | Domain d1kdha1: 1kdh A:148-242 [72349] Other proteins in same PDB: d1kdha3, d1kdha4 complexed with bro, mg, na |
PDB Entry: 1kdh (more details), 3 Å
SCOP Domain Sequences for d1kdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdha1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)} kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits mkdtegipclgdkvksiiegiiedgesseakavln
Timeline for d1kdha1: