Lineage for d1kd1l_ (1kd1 L:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462753Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 462754Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 462755Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 462756Protein Ribosomal protein L14 [50195] (2 species)
  7. 462757Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (19 PDB entries)
  8. 462768Domain d1kd1l_: 1kd1 L: [72334]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1l_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1l_ b.39.1.1 (L:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1kd1l_:

Click to download the PDB-style file with coordinates for d1kd1l_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1l_: