Lineage for d1kd1d_ (1kd1 D:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801391Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 801392Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 801393Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 801445Domain d1kd1d_: 1kd1 D: [72325]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1d_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
PDB Compounds: (D:) ribosomal protein l3

SCOP Domain Sequences for d1kd1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1d_ b.43.3.2 (D:) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d1kd1d_:

Click to download the PDB-style file with coordinates for d1kd1d_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1d_: