Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) automatically mapped to Pfam PF01907 |
Protein Ribosomal protein L37e [57834] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries) Uniprot P32410 |
Domain d1kd12_: 1kd1 2: [72320] Other proteins in same PDB: d1kd11_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_ complexed with cd, cl, k, mg, na, spr |
PDB Entry: 1kd1 (more details), 3 Å
SCOPe Domain Sequences for d1kd12_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kd12_ g.41.8.2 (2:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1kd12_:
View in 3D Domains from other chains: (mouse over for more information) d1kd11_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_ |