SCOP 1.61: Domain d1kcul2: 1kcu L:108-214

Lineage for d1kcul2 (1kcu L:108-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-hepatitis B Fab pc287, (mouse), kappa L chain [74834] (2 PDB entries)

8. Domain d1kcul2: 1kcu L:108-214 [72314]
   Other proteins in same PDB: d1kcuh1, d1kcul1

Details for d1kcul2

PDB Entry: 1kcu, 2.2 Å

PDB Description: crystal structure of antibody pc287

SCOP Domain Sequences for d1kcul2:

Sequence; same for both SEQRES and ATOM records:

>d1kcul2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-hepatitis B Fab pc287, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvanswtaqd
skdstysmsstltltkdeyerhnsytceathktstspvvksfnrnec

Timeline for d1kcul2:

• d1kcul2 is new in SCOP 1.61
  
• d1kcul2 appears in SCOP 1.63
  
• d1kcul2 appears in the current release, SCOPe 2.08