SCOPe 2.03: Domain d1kcuh1: 1kcu H:1-116

Lineage for d1kcuh1 (1kcu H:1-116)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d1kcuh1: 1kcu H:1-116 [72311]
   Other proteins in same PDB: d1kcuh2, d1kcul1, d1kcul2
   part of anti-hepatitis B Fab pc287

Details for d1kcuh1

PDB Entry: 1kcu, 2.2 Å

PDB Description: crystal structure of antibody pc287

PDB Compounds: (H:) pc287 immunoglobulin

SCOPe Domain Sequences for d1kcuh1:

Sequence; same for both SEQRES and ATOM records:

>d1kcuh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
qvklqqsgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmayisysgstty
npslksrisitrdtsknqfflqlnsvttedtaiyycarggtgfdywgagttltvsa

Timeline for d1kcuh1:

• d1kcuh1 first appeared in SCOP 1.61
  
• d1kcuh1 appears in SCOPe 2.02
  
• d1kcuh1 appears in SCOPe 2.04
  
• d1kcuh1 appears in the current release, SCOPe 2.08