SCOP 1.61: Domain d1kcuh1: 1kcu H:1-116

Lineage for d1kcuh1 (1kcu H:1-116)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-hepatitis B Fab pc287, (mouse), kappa L chain [74817] (2 PDB entries)

8. Domain d1kcuh1: 1kcu H:1-116 [72311]
   Other proteins in same PDB: d1kcuh2, d1kcul2

Details for d1kcuh1

PDB Entry: 1kcu, 2.2 Å

PDB Description: crystal structure of antibody pc287

SCOP Domain Sequences for d1kcuh1:

Sequence; same for both SEQRES and ATOM records:

>d1kcuh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab pc287, (mouse), kappa L chain}
qvklqqsgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmayisysgstty
npslksrisitrdtsknqfflqlnsvttedtaiyycarggtgfdywgagttltvsa

Timeline for d1kcuh1:

• d1kcuh1 is new in SCOP 1.61
  
• d1kcuh1 appears in SCOP 1.63
  
• d1kcuh1 appears in the current release, SCOPe 2.08