Lineage for d1kcsl2 (1kcs L:108-214)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159305Species Anti-hepatitis B Fab pc282, (mouse), kappa L chain [74833] (2 PDB entries)
  8. 159309Domain d1kcsl2: 1kcs L:108-214 [72310]
    Other proteins in same PDB: d1kcsh1, d1kcsl1

Details for d1kcsl2

PDB Entry: 1kcs (more details), 2.5 Å

PDB Description: crystal structure of antibody pc282 in complex with ps1 peptide

SCOP Domain Sequences for d1kcsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcsl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-hepatitis B Fab pc282, (mouse), kappa L chain}
radaaptssifppsseqlssggasvvcflnsfypksiavkwkvdgskrangtanswtdqd
sasstysmsstltltkdkyerhnsytceathktssspvvksfnrnec

SCOP Domain Coordinates for d1kcsl2:

Click to download the PDB-style file with coordinates for d1kcsl2.
(The format of our PDB-style files is described here.)

Timeline for d1kcsl2:

Domains from same chain:
(mouse over for more information)
d1kcsl1
Domains from other chains:
(mouse over for more information)
d1kcsh1, d1kcsh2