Lineage for d1kcsh1 (1kcs H:1-116)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782518Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 782542Domain d1kcsh1: 1kcs H:1-116 [72307]
    Other proteins in same PDB: d1kcsh2, d1kcsl1, d1kcsl2
    part of anti-hepatitis B Fab pc282; complex with ps1 peptide

Details for d1kcsh1

PDB Entry: 1kcs (more details), 2.5 Å

PDB Description: crystal structure of antibody pc282 in complex with ps1 peptide
PDB Compounds: (H:) pc282 immunoglobulin

SCOP Domain Sequences for d1kcsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcsh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
qvtlsqsgpglvkpsqslsltctvtsysitsdyawnwirqfagqslewmgyisysgstsy
npslksrisitrdtsknqfflqlnsvttddtatyycarggtgfpywgtgtnvtvsa

SCOP Domain Coordinates for d1kcsh1:

Click to download the PDB-style file with coordinates for d1kcsh1.
(The format of our PDB-style files is described here.)

Timeline for d1kcsh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcsh2