Lineage for d1kcrl1 (1kcr L:1-106)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653681Domain d1kcrl1: 1kcr L:1-106 [72305]
    Other proteins in same PDB: d1kcrh1, d1kcrh2, d1kcrl2
    part of anti-hepatitis B Fab pc283; complexed with ps1 peptide

Details for d1kcrl1

PDB Entry: 1kcr (more details), 2.9 Å

PDB Description: crystal structure of antibody pc283 in complex with ps1 peptide
PDB Compounds: (L:) pc283 immunoglobulin

SCOP Domain Sequences for d1kcrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcrl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftlkissvqaedladyhcgqtysyptfgggtklaik

SCOP Domain Coordinates for d1kcrl1:

Click to download the PDB-style file with coordinates for d1kcrl1.
(The format of our PDB-style files is described here.)

Timeline for d1kcrl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcrl2