Lineage for d1kcrl1 (1kcr L:1-106)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157519Species Anti-hepatitis B Fab pc283, (mouse), kappa L chain [74815] (1 PDB entry)
  8. 157521Domain d1kcrl1: 1kcr L:1-106 [72305]
    Other proteins in same PDB: d1kcrh2, d1kcrl2

Details for d1kcrl1

PDB Entry: 1kcr (more details), 2.9 Å

PDB Description: crystal structure of antibody pc283 in complex with ps1 peptide

SCOP Domain Sequences for d1kcrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcrl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab pc283, (mouse), kappa L chain}
divltqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftlkissvqaedladyhcgqtysyptfgggtklaik

SCOP Domain Coordinates for d1kcrl1:

Click to download the PDB-style file with coordinates for d1kcrl1.
(The format of our PDB-style files is described here.)

Timeline for d1kcrl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcrl2