![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
![]() | Species Anti-hepatitis B Fab pc283, (mouse), kappa L chain [74815] (1 PDB entry) |
![]() | Domain d1kcrl1: 1kcr L:1-106 [72305] Other proteins in same PDB: d1kcrh2, d1kcrl2 |
PDB Entry: 1kcr (more details), 2.9 Å
SCOP Domain Sequences for d1kcrl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcrl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab pc283, (mouse), kappa L chain} divltqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd rftgsgsatdftlkissvqaedladyhcgqtysyptfgggtklaik
Timeline for d1kcrl1: