SCOP 1.63: Domain d1kcrh2: 1kcr H:117-218

Lineage for d1kcrh2 (1kcr H:117-218)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-hepatitis B Fab pc283, (mouse), kappa L chain [74832] (1 PDB entry)

8. Domain d1kcrh2: 1kcr H:117-218 [72304]
   Other proteins in same PDB: d1kcrh1, d1kcrl1
   complex with ps1 peptide

Details for d1kcrh2

PDB Entry: 1kcr, 2.9 Å

PDB Description: crystal structure of antibody pc283 in complex with ps1 peptide

SCOP Domain Sequences for d1kcrh2:

Sequence; same for both SEQRES and ATOM records:

>d1kcrh2 b.1.1.2 (H:117-218) Immunoglobulin (constant domains of L and H chains) {Anti-hepatitis B Fab pc283, (mouse), kappa L chain}
aattppsvyplapgsaaaaaamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsa
lytlsssvtvpssprpsatvtcnvahpasstkvdkkivprdc

Timeline for d1kcrh2:

• d1kcrh2 first appeared in SCOP 1.61
  
• d1kcrh2 appears in SCOP 1.65
  
• d1kcrh2 appears in the current release, SCOPe 2.07