![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
![]() | Species Anti-hepatitis B Fab pc283, (mouse), kappa L chain [74832] (1 PDB entry) |
![]() | Domain d1kcrh2: 1kcr H:117-218 [72304] Other proteins in same PDB: d1kcrh1, d1kcrl1 |
PDB Entry: 1kcr (more details), 2.9 Å
SCOP Domain Sequences for d1kcrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcrh2 b.1.1.2 (H:117-218) Immunoglobulin (constant domains of L and H chains) {Anti-hepatitis B Fab pc283, (mouse), kappa L chain} aattppsvyplapgsaaaaaamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsa lytlsssvtvpssprpsatvtcnvahpasstkvdkkivprdc
Timeline for d1kcrh2: