SCOP 1.67: Domain d1kc5l1: 1kc5 L:1-107

Lineage for d1kc5l1 (1kc5 L:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1kc5l1: 1kc5 L:1-107 [72296]
   Other proteins in same PDB: d1kc5h1, d1kc5h2, d1kc5l2
   part of anti-hepatitis B Fab pc287; complex with ps1 peptide

Details for d1kc5l1

PDB Entry: 1kc5, 2.5 Å

PDB Description: crystal structure of antibody pc287 in complex with ps1 peptide

SCOP Domain Sequences for d1kc5l1:

Sequence; same for both SEQRES and ATOM records:

>d1kc5l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspksmsmsvgekvtlsckasenvdtyvswyqqrpeqppalliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqsysypltfgggtklelk

Timeline for d1kc5l1:

• d1kc5l1 first appeared in SCOP 1.61
  
• d1kc5l1 appears in SCOP 1.65
  
• d1kc5l1 appears in SCOP 1.69
  
• d1kc5l1 appears in the current release, SCOPe 2.08