Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein Bungarotoxin [57324] (4 species) |
Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries) |
Domain d1kc4a_: 1kc4 A: [72293] complex with the principal binding sequence on the alpha7 subunit of a neuronal nicotinic acetylcholine receptor, chain B |
PDB Entry: 1kc4 (more details)
SCOPe Domain Sequences for d1kc4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc4a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]} ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc stdkcnphpkqrpg
Timeline for d1kc4a_: