Class b: All beta proteins [48724] (119 folds) |
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Animal alpha-amylase [51024] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [51026] (18 PDB entries) |
Domain d1kbka1: 1kbk A:404-496 [72282] Other proteins in same PDB: d1kbka2 complexed with ca, cl, nag, pca; mutant |
PDB Entry: 1kbk (more details), 1.9 Å
SCOP Domain Sequences for d1kbka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbka1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)} qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct gikiyvsddgkahfsisnsaedpfiaihaeskl
Timeline for d1kbka1: