SCOP 1.63: Domain d1kbka1: 1kbk A:404-496

Lineage for d1kbka1 (1kbk A:404-496)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (18 PDB entries)

8. Domain d1kbka1: 1kbk A:404-496 [72282]
   Other proteins in same PDB: d1kbka2
   complexed with ca, cl, nag, pca; mutant

Details for d1kbka1

PDB Entry: 1kbk, 1.9 Å

PDB Description: mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids

SCOP Domain Sequences for d1kbka1:

Sequence; same for both SEQRES and ATOM records:

>d1kbka1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1kbka1:

• d1kbka1 first appeared in SCOP 1.61
  
• d1kbka1 appears in SCOP 1.65
  
• d1kbka1 appears in the current release, SCOPe 2.08