Lineage for d1kbib1 (1kbi B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172977Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 172978Family c.1.4.1: FMN-linked oxidoreductases [51396] (11 proteins)
  6. 173030Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 173031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (7 PDB entries)
  8. 173033Domain d1kbib1: 1kbi B: [72279]
    Other proteins in same PDB: d1kbia2

Details for d1kbib1

PDB Entry: 1kbi (more details), 2.3 Å

PDB Description: Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast Flavocytochrome b2: Comparison with the Intact Wild-type Enzyme

SCOP Domain Sequences for d1kbib1:

Sequence, based on SEQRES records: (download)

>d1kbib1 c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
pgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenh
nayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgq
gvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalf
vtvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieel
kkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqr
nlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdei
emsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1kbib1 c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
pgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenh
nayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgq
gvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalf
vtvdapslgqrekdmklkfsntktnveesqgasralskfidpsltwkdieelkkktklpi
vikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklev
fvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllg
vtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1kbib1:

Click to download the PDB-style file with coordinates for d1kbib1.
(The format of our PDB-style files is described here.)

Timeline for d1kbib1: