Lineage for d1kbba2 (1kbb A:1-403)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818197Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 1818198Species Human (Homo sapiens) [TaxId:9606] [51460] (49 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 1818215Domain d1kbba2: 1kbb A:1-403 [72276]
    Other proteins in same PDB: d1kbba1
    complexed with ca, cl; mutant

Details for d1kbba2

PDB Entry: 1kbb (more details), 1.9 Å

PDB Description: mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1kbba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbba2 c.1.8.1 (A:1-403) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqavidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdg

SCOPe Domain Coordinates for d1kbba2:

Click to download the PDB-style file with coordinates for d1kbba2.
(The format of our PDB-style files is described here.)

Timeline for d1kbba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbba1