Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Animal alpha-amylase [51024] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [51026] (49 PDB entries) Uniprot P04746 16-511 ! SQ 04746 |
Domain d1kb3a1: 1kb3 A:404-496 [72269] Other proteins in same PDB: d1kb3a2 complexed with ca, nag |
PDB Entry: 1kb3 (more details), 2.1 Å
SCOPe Domain Sequences for d1kb3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb3a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]} qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct gikiyvsddgkahfsisnsaedpfiaihaeskl
Timeline for d1kb3a1: