Lineage for d1k9mz_ (1k9m Z:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310311Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 310340Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 310341Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 310342Protein Ribosomal protein L32e [52044] (1 species)
  7. 310343Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (12 PDB entries)
  8. 310352Domain d1k9mz_: 1k9m Z: [72237]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mz_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9mz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mz_ c.9.2.1 (Z:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1k9mz_:

Click to download the PDB-style file with coordinates for d1k9mz_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mz_: