Lineage for d1k9mi_ (1k9m I:)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1252630Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1252631Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1252632Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1252633Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1252634Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1252670Domain d1k9mi_: 1k9m I: [72220]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mi_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1k9mi_:

Sequence, based on SEQRES records: (download)

>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1k9mi_:

Click to download the PDB-style file with coordinates for d1k9mi_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mi_: