Lineage for d1k9ae3 (1k9a E:178-450)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197388Family d.144.1.2: Tyrosine kinase [56150] (13 proteins)
  6. 197406Protein Carboxyl-terminal src kinase (csk) [56164] (1 species)
  7. 197407Species Human (Homo sapiens) [TaxId:9606] [56165] (2 PDB entries)
  8. 197413Domain d1k9ae3: 1k9a E:178-450 [72202]
    Other proteins in same PDB: d1k9aa1, d1k9aa2, d1k9ab1, d1k9ab2, d1k9ac1, d1k9ac2, d1k9ad1, d1k9ad2, d1k9ae1, d1k9ae2, d1k9af1, d1k9af2

Details for d1k9ae3

PDB Entry: 1k9a (more details), 2.5 Å

PDB Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution

SCOP Domain Sequences for d1k9ae3:

Sequence, based on SEQRES records: (download)

>d1k9ae3 d.144.1.2 (E:178-450) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
aaqdefyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaea
svmtqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsld
vceameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapea
lrekkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyd
vmkncwhldaatrptflqlreqlehirthelhl

Sequence, based on observed residues (ATOM records): (download)

>d1k9ae3 d.144.1.2 (E:178-450) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
aaqdefyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaea
svmtqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsld
vceameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstlpvkwtapealrekk
fstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmknc
whldaatrptflqlreqlehirthelhl

SCOP Domain Coordinates for d1k9ae3:

Click to download the PDB-style file with coordinates for d1k9ae3.
(The format of our PDB-style files is described here.)

Timeline for d1k9ae3: