Lineage for d1k9ae1 (1k9a E:6-76)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227637Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 227638Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)
  8. 227647Domain d1k9ae1: 1k9a E:6-76 [72200]
    Other proteins in same PDB: d1k9aa2, d1k9aa3, d1k9ab2, d1k9ab3, d1k9ac2, d1k9ac3, d1k9ad2, d1k9ad3, d1k9ae2, d1k9ae3, d1k9af2, d1k9af3

Details for d1k9ae1

PDB Entry: 1k9a (more details), 2.5 Å

PDB Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution

SCOP Domain Sequences for d1k9ae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ae1 b.34.2.1 (E:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
qkregvkagtk

SCOP Domain Coordinates for d1k9ae1:

Click to download the PDB-style file with coordinates for d1k9ae1.
(The format of our PDB-style files is described here.)

Timeline for d1k9ae1: