Lineage for d1k9ac3 (1k9a C:178-450)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980250Protein Carboxyl-terminal src kinase (csk) [56164] (1 species)
    PTK group; CSK subfamily; non-membrane spanning protein tyrosine kinase
  7. 2980251Species Human (Homo sapiens) [TaxId:9606] [56165] (4 PDB entries)
  8. 2980255Domain d1k9ac3: 1k9a C:178-450 [72196]
    Other proteins in same PDB: d1k9aa1, d1k9aa2, d1k9ab1, d1k9ab2, d1k9ac1, d1k9ac2, d1k9ad1, d1k9ad2, d1k9ae1, d1k9ae2, d1k9af1, d1k9af2

Details for d1k9ac3

PDB Entry: 1k9a (more details), 2.5 Å

PDB Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution
PDB Compounds: (C:) Carboxyl-terminal Src kinase

SCOPe Domain Sequences for d1k9ac3:

Sequence, based on SEQRES records: (download)

>d1k9ac3 d.144.1.7 (C:178-450) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
aaqdefyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaea
svmtqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsld
vceameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapea
lrekkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyd
vmkncwhldaatrptflqlreqlehirthelhl

Sequence, based on observed residues (ATOM records): (download)

>d1k9ac3 d.144.1.7 (C:178-450) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
aaqdefyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaea
svmtqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsld
vceameylegnnfvhrdlaarnvlvsednvakvsdfgltkeaslpvkwtapealrekkfs
tksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwh
ldaatrptflqlreqlehirthelhl

SCOPe Domain Coordinates for d1k9ac3:

Click to download the PDB-style file with coordinates for d1k9ac3.
(The format of our PDB-style files is described here.)

Timeline for d1k9ac3: