Lineage for d1k9ac1 (1k9a C:6-76)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295610Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 295611Family b.34.2.1: SH3-domain [50045] (26 proteins)
  6. 295683Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 295684Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)
  8. 295691Domain d1k9ac1: 1k9a C:6-76 [72194]
    Other proteins in same PDB: d1k9aa2, d1k9aa3, d1k9ab2, d1k9ab3, d1k9ac2, d1k9ac3, d1k9ad2, d1k9ad3, d1k9ae2, d1k9ae3, d1k9af2, d1k9af3

Details for d1k9ac1

PDB Entry: 1k9a (more details), 2.5 Å

PDB Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution

SCOP Domain Sequences for d1k9ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ac1 b.34.2.1 (C:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
qkregvkagtk

SCOP Domain Coordinates for d1k9ac1:

Click to download the PDB-style file with coordinates for d1k9ac1.
(The format of our PDB-style files is described here.)

Timeline for d1k9ac1: