Lineage for d1k9ab2 (1k9a B:77-177)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965330Protein Carboxyl-terminal src kinase (csk) [75498] (1 species)
  7. 2965331Species Human (Homo sapiens) [TaxId:9606] [75499] (1 PDB entry)
  8. 2965333Domain d1k9ab2: 1k9a B:77-177 [72192]
    Other proteins in same PDB: d1k9aa1, d1k9aa3, d1k9ab1, d1k9ab3, d1k9ac1, d1k9ac3, d1k9ad1, d1k9ad3, d1k9ae1, d1k9ae3, d1k9af1, d1k9af3

Details for d1k9ab2

PDB Entry: 1k9a (more details), 2.5 Å

PDB Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution
PDB Compounds: (B:) Carboxyl-terminal Src kinase

SCOPe Domain Sequences for d1k9ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ab2 d.93.1.1 (B:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
lslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyhas
klsideevyfenlmqlvehyttdadglctrlikpkvmegtv

SCOPe Domain Coordinates for d1k9ab2:

Click to download the PDB-style file with coordinates for d1k9ab2.
(The format of our PDB-style files is described here.)

Timeline for d1k9ab2: