Lineage for d1k9aa1 (1k9a A:6-76)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165492Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 165493Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)
  8. 165498Domain d1k9aa1: 1k9a A:6-76 [72188]
    Other proteins in same PDB: d1k9aa2, d1k9aa3, d1k9ab2, d1k9ab3, d1k9ac2, d1k9ac3, d1k9ad2, d1k9ad3, d1k9ae2, d1k9ae3, d1k9af2, d1k9af3

Details for d1k9aa1

PDB Entry: 1k9a (more details), 2.5 Å

PDB Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution

SCOP Domain Sequences for d1k9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
qkregvkagtk

SCOP Domain Coordinates for d1k9aa1:

Click to download the PDB-style file with coordinates for d1k9aa1.
(The format of our PDB-style files is described here.)

Timeline for d1k9aa1: