Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Carboxyl-terminal src kinase (csk) [74654] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries) |
Domain d1k9aa1: 1k9a A:6-76 [72188] Other proteins in same PDB: d1k9aa2, d1k9aa3, d1k9ab2, d1k9ab3, d1k9ac2, d1k9ac3, d1k9ad2, d1k9ad3, d1k9ae2, d1k9ae3, d1k9af2, d1k9af3 |
PDB Entry: 1k9a (more details), 2.5 Å
SCOPe Domain Sequences for d1k9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv qkregvkagtk
Timeline for d1k9aa1: