Lineage for d1k8rb_ (1k8r B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402897Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1402949Protein Protein kinase byr2 [69662] (1 species)
  7. 1402950Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [69663] (2 PDB entries)
  8. 1402951Domain d1k8rb_: 1k8r B: [72180]
    Other proteins in same PDB: d1k8ra_
    complex with Ras
    complexed with gnp, mg

Details for d1k8rb_

PDB Entry: 1k8r (more details), 3 Å

PDB Description: Crystal structure of Ras-Bry2RBD complex
PDB Compounds: (B:) protein kinase byr2

SCOPe Domain Sequences for d1k8rb_:

Sequence, based on SEQRES records: (download)

>d1k8rb_ d.15.1.5 (B:) Protein kinase byr2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
cilrfiacngqtravqsrgdyqktlaialkkfsledaskfivcvsqssrikliteeefkq
icfnsssperdrliivpkekpcpsfedlrrsweie

Sequence, based on observed residues (ATOM records): (download)

>d1k8rb_ d.15.1.5 (B:) Protein kinase byr2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
cilrfiacngqtravqsrgdyqktlaialkkfsledaskfivcvsqssrikliteerdrl
iivpkekpcpsfedlrrsweie

SCOPe Domain Coordinates for d1k8rb_:

Click to download the PDB-style file with coordinates for d1k8rb_.
(The format of our PDB-style files is described here.)

Timeline for d1k8rb_: