Lineage for d1k8az_ (1k8a Z:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690198Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 690234Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 690235Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 690236Protein Ribosomal protein L32e [52044] (1 species)
  7. 690237Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (40 PDB entries)
  8. 690256Domain d1k8az_: 1k8a Z: [72170]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8az_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (Z:) ribosomal protein l32e

SCOP Domain Sequences for d1k8az_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8az_ c.9.2.1 (Z:) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1k8az_:

Click to download the PDB-style file with coordinates for d1k8az_.
(The format of our PDB-style files is described here.)

Timeline for d1k8az_: