Lineage for d1k8ay_ (1k8a Y:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601361Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 601362Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 601363Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 601364Protein Ribosomal protein L31e [54577] (1 species)
  7. 601365Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (19 PDB entries)
  8. 601377Domain d1k8ay_: 1k8a Y: [72169]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8ay_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8ay_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ay_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1k8ay_:

Click to download the PDB-style file with coordinates for d1k8ay_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ay_: