| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) ![]() many known members contain KOW motif |
| Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
| Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries) Uniprot P10972 |
| Domain d1k8au_: 1k8a U: [72165] Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ complexed with cai, cd, cl, k, mg, na |
PDB Entry: 1k8a (more details), 3 Å
SCOP Domain Sequences for d1k8au_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8au_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d1k8au_:
View in 3DDomains from other chains: (mouse over for more information) d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ |