SCOPe 2.01: Domain d1k8ai_: 1k8a I:

Lineage for d1k8ai_ (1k8a I:)

1. Root: SCOPe 2.01

2. Class j: Peptides [58231] (120 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d1k8ai_: 1k8a I: [72153]
   Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
   complexed with cai, cd, cl, k, mg, na

Details for d1k8ai_

PDB Entry: 1k8a, 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1k8ai_:

Sequence, based on SEQRES records:

>d1k8ai_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1k8ai_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1k8ai_:

• d1k8ai_ first appeared in SCOP 1.61
  
• d1k8ai_ appears in SCOP 1.75
  
• d1k8ai_ appears in SCOPe 2.02
  
• d1k8ai_ appears in the current release, SCOPe 2.08