Lineage for d1k8af_ (1k8a F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727201Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 727202Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 727203Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 727204Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 727205Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
  8. 727224Domain d1k8af_: 1k8a F: [72149]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8af_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (F:) ribosomal protein l5

SCOP Domain Sequences for d1k8af_:

Sequence, based on SEQRES records: (download)

>d1k8af_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1k8af_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1k8af_:

Click to download the PDB-style file with coordinates for d1k8af_.
(The format of our PDB-style files is described here.)

Timeline for d1k8af_: