Lineage for d1k8a4_ (1k8a 4:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893376Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 893481Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 893482Protein Ribosomal protein L44e [57837] (1 species)
  7. 893483Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 893517Domain d1k8a4_: 1k8a 4: [72144]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8a4_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (4:) ribosomal protein l44e

SCOP Domain Sequences for d1k8a4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8a4_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1k8a4_:

Click to download the PDB-style file with coordinates for d1k8a4_.
(The format of our PDB-style files is described here.)

Timeline for d1k8a4_: