SCOPe 2.07: Domain d1k77a1: 1k77 A:1-258

Lineage for d1k77a1 (1k77 A:1-258)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.5: Hypothetical protein YgbM (EC1530) [75093] (1 protein)
   automatically mapped to Pfam PF01261

6. Protein Hypothetical protein YgbM (EC1530) [75094] (1 species)

7. Species Escherichia coli [TaxId:562] [75095] (1 PDB entry)

8. Domain d1k77a1: 1k77 A:1-258 [72096]
   Other proteins in same PDB: d1k77a2
   Structural genomics
   complexed with fmt, gol, mg

Details for d1k77a1

PDB Entry: 1k77, 1.63 Å

PDB Description: Crystal Structure of EC1530, a Putative Oxygenase from Escherichia coli

PDB Compounds: (A:) Hypothetical protein ygbM

SCOPe Domain Sequences for d1k77a1:

Sequence; same for both SEQRES and ATOM records:

>d1k77a1 c.1.15.5 (A:1-258) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]}
mprfaanlsmmftevpfierfaaarkagfdaveflfpynystlqiqkqleqnhltlalfn
tapgdinagewglsalpgreheahadidlaleyalalnceqvhvmagvvpagedaeryra
vfidniryaadrfaphgkrilvealspgvkphylfssqyqalaiveevardnvfiqldtf
haqkvdgnlthlirdyagkyahvqiaglpdrhepddgeinypwlfrlfdevgyqgwigce
ykprglteeglgwfdawr

Timeline for d1k77a1:

• d1k77a1 first appeared in SCOP 1.61, called d1k77a_
  
• d1k77a1 appears in SCOPe 2.06
  
• d1k77a1 appears in the current release, SCOPe 2.08