SCOP 1.61: Domain d1k6ql2: 1k6q L:108-210

Lineage for d1k6ql2 (1k6q L:108-210)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-human tissue factor Fab D3 (mouse), kappa L chain [74827] (1 PDB entry)

8. Domain d1k6ql2: 1k6q L:108-210 [72095]
   Other proteins in same PDB: d1k6qh1, d1k6ql1

Details for d1k6ql2

PDB Entry: 1k6q, 2.4 Å

PDB Description: Crystal structure of antibody Fab fragment D3

SCOP Domain Sequences for d1k6ql2:

Sequence, based on SEQRES records:

>d1k6ql2 b.1.1.2 (L:108-210) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab D3 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records):

>d1k6ql2 b.1.1.2 (L:108-210) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab D3 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatpivksfn

Timeline for d1k6ql2:

• d1k6ql2 is new in SCOP 1.61
  
• d1k6ql2 appears in SCOP 1.63
  
• d1k6ql2 appears in the current release, SCOPe 2.08