Lineage for d1k6qh2 (1k6q H:118-216)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220997Species Anti-human tissue factor Fab D3 (mouse), kappa L chain [74827] (1 PDB entry)
  8. 220998Domain d1k6qh2: 1k6q H:118-216 [72093]
    Other proteins in same PDB: d1k6qh1, d1k6ql1

Details for d1k6qh2

PDB Entry: 1k6q (more details), 2.4 Å

PDB Description: Crystal structure of antibody Fab fragment D3

SCOP Domain Sequences for d1k6qh2:

Sequence, based on SEQRES records: (download)

>d1k6qh2 b.1.1.2 (H:118-216) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab D3 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkkip

Sequence, based on observed residues (ATOM records): (download)

>d1k6qh2 b.1.1.2 (H:118-216) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab D3 (mouse), kappa L chain}
akttppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkkip

SCOP Domain Coordinates for d1k6qh2:

Click to download the PDB-style file with coordinates for d1k6qh2.
(The format of our PDB-style files is described here.)

Timeline for d1k6qh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k6qh1