![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries) SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) |
![]() | Domain d1k6qh1: 1k6q H:1-117 [72092] Other proteins in same PDB: d1k6qh2, d1k6ql1, d1k6ql2 part of anti-human tissue factor Fab D3 |
PDB Entry: 1k6q (more details), 2.4 Å
SCOPe Domain Sequences for d1k6qh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6qh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]} evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvss
Timeline for d1k6qh1: