SCOP 1.69: Domain d1k6qh1: 1k6q H:1-117

Lineage for d1k6qh1 (1k6q H:1-117)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (28 PDB entries)

8. Domain d1k6qh1: 1k6q H:1-117 [72092]
   Other proteins in same PDB: d1k6qh2, d1k6ql1, d1k6ql2
   part of anti-human tissue factor Fab D3

Details for d1k6qh1

PDB Entry: 1k6q, 2.4 Å

PDB Description: Crystal structure of antibody Fab fragment D3

SCOP Domain Sequences for d1k6qh1:

Sequence; same for both SEQRES and ATOM records:

>d1k6qh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy
dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvss

Timeline for d1k6qh1:

• d1k6qh1 first appeared in SCOP 1.61
  
• d1k6qh1 appears in SCOP 1.67
  
• d1k6qh1 appears in SCOP 1.71
  
• d1k6qh1 appears in the current release, SCOPe 2.08