SCOPe 2.03: Domain d1k6nm_: 1k6n M:

Lineage for d1k6nm_ (1k6n M:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (55 PDB entries)
   Uniprot P02953

8. Domain d1k6nm_: 1k6n M: [72091]
   Other proteins in same PDB: d1k6nh1, d1k6nh2, d1k6nl_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d1k6nm_

PDB Entry: 1k6n, 3.1 Å

PDB Description: e(l212)a,d(l213)a double mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d1k6nm_:

Sequence; same for both SEQRES and ATOM records:

>d1k6nm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1k6nm_:

• d1k6nm_ first appeared in SCOP 1.61, called d1k6nm1
  
• d1k6nm_ appears in SCOPe 2.02
  
• d1k6nm_ appears in SCOPe 2.04
  
• d1k6nm_ appears in the current release, SCOPe 2.08