SCOPe 2.06: Domain d1k6ll_: 1k6l L:

Lineage for d1k6ll_ (1k6l L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
   Uniprot P02954

8. Domain d1k6ll_: 1k6l L: [72086]
   Other proteins in same PDB: d1k6lh1, d1k6lh2, d1k6lm_
   complexed with bcl, bph, cdl, fe, lda, spn, u10

Details for d1k6ll_

PDB Entry: 1k6l, 3.1 Å

PDB Description: Photosynethetic Reaction Center from Rhodobacter sphaeroides

PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d1k6ll_:

Sequence; same for both SEQRES and ATOM records:

>d1k6ll_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1k6ll_:

• d1k6ll_ first appeared in SCOP 1.61, called d1k6ll1
  
• d1k6ll_ appears in SCOPe 2.05
  
• d1k6ll_ appears in SCOPe 2.07
  
• d1k6ll_ appears in the current release, SCOPe 2.08