Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries) |
Domain d1k6ll_: 1k6l L: [72086] Other proteins in same PDB: d1k6lh1, d1k6lh2, d1k6lm_ complexed with bcl, bph, cdl, fe, lda, spn, u10 |
PDB Entry: 1k6l (more details), 3.1 Å
SCOP Domain Sequences for d1k6ll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6ll_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1k6ll_: