Class b: All beta proteins [48724] (174 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (4 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
Protein Photosynthetic reaction centre [50348] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries) Uniprot P11846 |
Domain d1k6lh1: 1k6l H:36-250 [72084] Other proteins in same PDB: d1k6lh2, d1k6ll_, d1k6lm_ complexed with bcl, bph, cdl, fe, lda, spn, u10 |
PDB Entry: 1k6l (more details), 3.1 Å
SCOP Domain Sequences for d1k6lh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6lh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d1k6lh1: