SCOP 1.75: Domain d1k6lh1: 1k6l H:36-250

Lineage for d1k6lh1 (1k6l H:36-250)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
   Uniprot P11846

8. Domain d1k6lh1: 1k6l H:36-250 [72084]
   Other proteins in same PDB: d1k6lh2, d1k6ll_, d1k6lm_
   complexed with bcl, bph, cdl, fe, lda, spn, u10

Details for d1k6lh1

PDB Entry: 1k6l, 3.1 Å

PDB Description: Photosynethetic Reaction Center from Rhodobacter sphaeroides

PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOP Domain Sequences for d1k6lh1:

Sequence; same for both SEQRES and ATOM records:

>d1k6lh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1k6lh1:

• d1k6lh1 first appeared in SCOP 1.61
  
• d1k6lh1 appears in SCOP 1.73
  
• d1k6lh1 appears in SCOPe 2.01
  
• d1k6lh1 appears in the current release, SCOPe 2.08